Glucagon-like peptide 1

$ 400.0

Quantity: 10 MG

In stock

SKU: 1208001 Categories: ,

Description

Product name: Glucagon-like peptide 1

Catalog#: 1208001

Organism: Human

Synonyms: GLP-1,Incretin hormone,

CAS NO.: 89750-14-1

Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Modifications:

M.F.: C149H226N40O45

M.W.: 3297.63

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: GLP-1 regulates glucose homeostasis by stimulating insulin secretion, inhibiting glucagon release, and delaying gastric emptying. Intravenous GLP-1 has been shown to increase insulin secretion in response to elevated glucose levels and offers therapeutic benefit for patients with type 2 diabetes. GLP-1 is of relevance to appetite and weight maintenance because it has actions on the gastrointestinal tract as well as the direct regulation of appetite.

Compound ID: 16135499

Uniprot ID: P01275

 

Usage: For Scientific Research Use Only, Not for Human Use.