Glucagon-like peptide 2

$ 400.0

Quantity: 10 MG

In stock

SKU: 1209001 Categories: ,

Description

Product name: Glucagon-like peptide 2

Catalog#: 1209001

Organism: Human

Synonyms: GLP-2,

CAS NO.:

Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Modifications:

M.W:3766.13

M.F.:C165H254N44O55S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Glucagon-like peptide-2 (GLP-2) is a newly discovered growth factor that has been demonstrated to enhance intestinal growth and function in normal rodents and to prevent damage and facilitate intestinal repair in various animal models of intestinal insufficiency. A recent study has demonstrated that GLP-2 also acts as an intestinotropin in humans with short-bowel syndrome.

Uniprot ID: P01275

 

Usage: For Scientific Research Use Only, Not for Human Use.