Glucagon-like peptide 2,pig

$350.00

Quantity: 10 MG

1 in stock

SKU: 1209003 Categories: ,

Description

Product name: Glucagon-like peptide 2,pig

Catalog#: 1209003

Organism: Pig

Synonyms: GLP-2,

CAS NO.:

Sequence: HADGSFSDEMNTVLDNLATRDFINWLLHTKITDSL

Modifications:

M.W:3991.37

M.F.:C175H269N47O58S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Glucagon-like peptide-2 (GLP-2) is a newly discovered growth factor that has been demonstrated to enhance intestinal growth and function in normal rodents and to prevent damage and facilitate intestinal repair in various animal models of intestinal insufficiency. A recent study has demonstrated that GLP-2 also acts as an intestinotropin in humans with short-bowel syndrome.

Uniprot ID: P01274

 

Usage: For Scientific Research Use Only, Not for Human Use.

Reviews

There are no reviews yet.

Be the first to review “Glucagon-like peptide 2,pig”

This website uses non-personal cookies to give you best relevant experience. Dismiss