PNC-27

$280.00

Quantity: 10mg

7 in stock

SKU: 1807025 Category:

Description

Product name: PNC-27

Catalog#: 1807025

Synonyms: p53 12–26-leader,p53-derived peptide,

Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

M.W: 4031.7

M.F.: C188H293N53O44S

Purity: 95%

Counter ion: Acetate

Format: Lyophilized powder

Description: PNC-27 and 28, containing HDM-2-protein-binding domain sequences from p53 linked on their C-termini to the MRP that induce pore formation in the membranes of a wide range of cancer cells but not any normal cells tested. PNC-27 and 28 both induce complete cytotoxicity to three different breast cancer cell lines in less than one hour when present in the incubation medium at 30 uM. PNC-27 induced total cell cytotoxicity in MDA-MB-468 and MDA-MB-157 cell lines in 30 minutes and induced extensive cell death in the MCF-7 line, which it completely killed in 2 hours. PNC-27, but not controls, induces release of high levels of lactate dehydrogenase (LDH), a cytosolic enzyme, indicative of tumor cell necrosis in the three human breast cancer cell lines.

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reviews

There are no reviews yet.

Be the first to review “PNC-27”

This website uses non-personal cookies to give you best relevant experience. Dismiss