Sermorelin

$360.00

Quantity: 50mg

9 in stock

Description

Product name: hGHRH(1-29)NH2

Catalog#: 1223002

Organism: Human

Synonyms: growth hormone releasing factor 1–29 NH2, Sermorelin,Sermorelina, Sermoreline, Sermorelinum,

CAS NO.: 86168-78-7

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Modifications: C-terminal amide

M.W: 3357.88

M.F.: C149H246N44O42S

Purity: 95%

Counter ion: Acetate

Format: Lyophilized powder

Description: Sermorelin is a well tolerated analogue of GHRH which is suitable for use as a provocative test of growth hormone deficiency when given as a single intravenous 1 microg/kg bodyweight dose in conjunction with conventional tests. Limited data suggest that once daily subcutaneous sermorelin 30 microg/kg bodyweight is effective in promoting growth in some prepubertal children with idiopathic growth hormone deficiency.

Uniprot ID: P01286

Compound ID: 16129620

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reviews

There are no reviews yet.

Be the first to review “Sermorelin”

Your email address will not be published. Required fields are marked *