Sermorelin

$360.00

Quantity: 50mg

9 in stock

SKU: 1223002 Category:

Description

Product name: Sermorelin

Catalog#: 1223002

Organism: Human

Synonyms: hGHRH(1-29)NH2 , growth hormone releasing factor 1–29 NH2, Sermorelin,Sermorelina, Sermoreline, Sermorelinum,

CAS NO.: 86168-78-7

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Modifications: C-terminal amide

M.W: 3357.88

M.F.: C149H246N44O42S

Purity: 95%

Counter ion: Acetate

Format: Lyophilized powder

Description: Sermorelin is a well tolerated analogue of GHRH which is suitable for use as a provocative test of growth hormone deficiency when given as a single intravenous 1 microg/kg bodyweight dose in conjunction with conventional tests. Limited data suggest that once daily subcutaneous sermorelin 30 microg/kg bodyweight is effective in promoting growth in some prepubertal children with idiopathic growth hormone deficiency.

Uniprot ID: P01286

Compound ID: 16129620

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reviews

There are no reviews yet.

Be the first to review “Sermorelin”

This website uses non-personal cookies to give you best relevant experience. Dismiss