$ 300.0
Quantity: 10 MG
In stock
Description
Product name: Peptide YY
Catalog#: 1215001
Organism: Human
Synonyms: PYY,PYY-I,Peptide tyrosine tyrosine,
CAS NO.:
Sequence: YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Modifications: c-terminal amide,
M.W:4409.89
M.F.:C198H303N57O58
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Hormone peptide tyrosine-tyrosine (PYY) is secreted into circulation from the gut L-endocrine cells in response to food intake, thus inducing satiation during interaction with its preferred receptor, Y2R. PYY acts through Y-receptor subtypes: Y1, Y2, Y4 and Y5 in humans. PYY(1-36) shows high affinity to all four receptors while PYY(3-36) is a specific Y2 agonist. PYY inhibits many GI functions, including gastric acid secretion, gastric emptying, small bowel and colonic chloride secretion, mouth to cecum transit time, pancreatic exocrine secretion and pancreatic insulin secretion. PYY also promotes postprandial naturesis and elevates systolic and diastolic blood pressure. PYY(1-36) and PYY(3-36) cross the blood-brain barrier and participate in appetite and weight control regulation. PYY(1-36) acting through Y1- and Y5-receptors increases appetite and stimulates weight gain. PYY(3-36) acting through Y2-receptors on NPY-containing cells in the arcuate nucleus inhibits NPY release and, thereby, decreases appetite and promotes weight loss. PYY may play a primary role in the appetite suppression and weight loss observed after bariatric operations.
Uniprot ID: P10082
Usage: For Scientific Research Use Only, Not for Human Use.
