$ 300.0
Quantity: 10 MG
In stock
Description
Product name: Peptide YY(3-36)
Catalog#: 1215102
Organism: Human
Synonyms: PYY-II, Anorexic peptide PYY3–36, Peptide YY3-36,
CAS NO.: 123583-37-9
Sequence: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Modifications: C-terminal amide,
M.W: 4049.53
M.F.: C180H279N53O54
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: PYY3–36 is thought to be a physiologic anorexigenic peptide.The chronic increase in salivary PYY(3-36) resulted in a significant long-term reduction in food intake (FI) and body weight (BW). Thus gut peptide PYY(3-36) suggesting a potential simple and efficient alternative therapeutic approach for the treatment of obesity. PYY3-36 is the predominant circulating form and its role in appetite control has been well-characterised; exogenous administration of PYY3-36 reduces food intake in both animals and humans whilst Pyy-null mice are hyperphagic and develop obesity.PYY3-36 acts in key homeostatic and reward brain regions to regulate feeding behavior.Peptide YY3–36 (PYY3–36) is a gut hormone with anorectic action that also affects energy expenditure.
Uniprot ID: P10082
Usage: For Scientific Research Use Only, Not for Human Use.
