$ 650.0
Quantity: 10 MG
In stock
Description
Product name: Urodilatin
Catalog#: 1229103
Organism: Human
Synonyms: ularitide,uro,ularitide,Atrial natriuretic factor prohormone (95-126), Atriopeptin (95-126),TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY,
CAS NO.: 115966-23-9
Sequence: Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr
Modifications: disulfide(11-27),
M.W: 3505.97
M.F.: C145H234N52O44S3
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Urodilatin is produced in humans by differential processing of pro-atrial natriuretic peptide in distal renal tubule cells. Physiologically, urodilatin appears to be the natriuretic peptide involved in sodium homeostasis. Ularitide exerts its pharmacological actions such as vasodilation, diuresis, and natriuresis through the natriuretic peptide receptor/particulate guanylate cyclase/cyclic guanosine monophosphate pathway. Urodilatin stimulates extraneuronal dopamine uptake in external renal cortex by activation of the type A natriuretic peptide receptor, coupled to cyclic guanylate monophosphate signaling and protein kinase G. Moreover, urodilatin enhances dopamine-induced inhibition of Na+, K+-ATPase activity in renal tubules.
Uniprot ID: P01160
Drug Bank ID: http://www.drugbank.ca/drugs/DB05034
Usage: For Scientific Research Use Only, Not for Human Use.
