OAIP-1

$ 950.0

Quantity: 1mg

SKU: 1808016 Category:

Description

Product name: OAIP-1

Catalog#: 1808016

Synonyms: orally active insecticidal peptide 1,U1-TRTX-Sp1a, DCGHLHDPCPNDRPGHRTCCIGLQCRYGKCLVRV,

Sequence: Asp-Cys-Gly-His-Leu-His-Asp-Pro-Cys-Pro-Asn-Asp-Arg-Pro-Gly-His-Arg-Thr-Cys-Cys-Ile-Gly-Leu-Gln-Cys-Arg-Tyr-Gly-Lys-Cys-Leu-Val-Arg-Val-NH2

Modifications: disulfide(1-4,2-5,3-6),C-terminal amide,

M.W: 3816.39

M.F.: C157H248N56O44S6

Purity: 95%

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Orally active insecticidal peptide (OAIP-1) is highly lethal to termites, mealworms, and the cotton bollworm.OAIP-1 remains completely intact for at least one week at temperatures up to 30°C and is stable for hours in insect hemolymph.

Uniprot ID:  K7N5K9

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Use coupon code : Q74SBZGH to save $100 NOW!

This website uses cookies to ensure your the best experience on shopping.

Dismiss