43RF-amides

$ 1,280.0

Quantity: 50 MG

In stock

Description

Product name: 43RF-amides

Catalog#: 2229002

Organism:

Synonyms: QRF-amide,Neuropeptide RF-amide,Pyroglutamylated arginine-phenylalanine-amide peptide,

CAS NO.:

Sequence: QDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRF

Modifications: n-terminal Pyr,c-terminal amide,

M.W:

M.F.:

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: P83859

Usage: For Scientific Research Use Only, Not for Human Use.