Antimicrobial peptide LL-37

$ 550.0

Quantity: 10 MG

In stock

Description

Product name: Antimicrobial peptide LL-37

Catalog#: 1301001

Organism: human

Synonyms: LL-37,Cathelicidin,hCAP-18,CAP-18,cationic antimicrobial protein,cationic antimicrobial peptide,LL 37, [LL-37, 37 aa],

CAS NO.: 154947-66-7

Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

M.W: 4493.26

M.F.: C205H340N60O53

Purity: 95%

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: hCAP-18 (the only member of the cathelicidin AMP family in humans) contains an N-terminal domain, a cathelin domain and a C-terminal LL-37 domain. LL-37 is extracellularly cleaved from hCAP-18 by proteinase 3 and belongs to the class of linear alpha peptides. LL-37 owes its name to the fact that it consists of 37 amino acids that begin with two leucine residues.Human LL-37 is able to defend against various bacterial and fungal pathogens.The host defense peptide LL-37 has emerged as a novel modulator of tumor growth and metastasis in carcinogenesis of various types of cancers. LL-37 is an antimicrobial peptide able of inducing various effects. It acts as an anti- and pro- inflammatory factor. Cathelicidins are able to directly and selectively destroy membranes of various microbes and cancer cells, but they do not attack normal cells. The role of cathelicidins in cancer is double-sided. They play an important role in killing cancer cells and may provide a new possibility for the development of cancer therapeutics. However, they also can participate in carcinogenesis. Due to its activity spectrum LL-37 could be applied in pharmacotherapy. Cathelicidin peptides could serve as a template for the development of modern anti-microbial and anti-viral drugs. LL-37 is an excellent candidate to develop into therapeutics for infected wounds..

Compound ID: 16198951

Uniprot ID: P49913

 

Usage: For Scientific Research Use Only, Not for Human Use.