Antimicrobial protein CAP7

$ 650.0

Quantity: 10 MG

In stock

Description

Product name: Antimicrobial protein CAP7

Catalog#: 1301006

Organism: Rabbit

Synonyms: CAP18,

CAS NO.:

Sequence: GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY

Modifications:

M.W:4453.40

M.F.:C204H352N64O47

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: P25230

Usage: For Scientific Research Use Only, Not for Human Use.