Apelin-36, Bovine

$ 450.0

Quantity: 10 MG

In stock

SKU: 1431006 Categories: ,

Description

Product name: Apelin-36

Catalog#: 1431006

Organism: Bovine

Synonyms: APJ endogenous ligand

CAS NO.:

Sequence: LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF

Modifications:

M.W:4178.86

M.F.:C185H298N68O42S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: Q9TUI9

Usage: For Scientific Research Use Only, Not for Human Use.