Apelin-36, rat

$ 450.0

Quantity: 10 MG

In stock

SKU: 1431005 Categories: ,

Description

Product name: Apelin-36

Catalog#: 1431005

Organism: Rat

Synonyms: APJ endogenous ligand

CAS NO.:

Sequence: LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF

Modifications:

M.W:4200.91

M.F.:C185H304N68O43S1

Quantity: 5mg

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: Q9R0R3

Usage: For Scientific Research Use Only, Not for Human Use.