$ 420.0
Quantity:1mg
In stock
Description
Product name: Beta-endorphin
Catalog#: 1265001
Organism: Human
Synonyms: Beta-Endorphin human, Beta-Endorphin, Beta-Lipotropin C-fragment, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE,
CAS NO.: 61214-51-5
Sequence: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu
M.W: 3465.03
M.F.: C158H251N39O46S
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: β-Endorphin (β-END) is an endogenous opioid peptide derived from the common precursor proopiomelanocortin, together with adrenocorticotropic hormone (ACTH) and melanocyte-stimulating hormone (MSH).
Uniprot ID: P01189
Usage: For Scientific Research Use Only, Not for Human Use.

