Big gastrin

$ 250.0

Quantity: 10 MG

In stock

Categories: ,

Description

Product name: Big gastrin

Catalog#: 1202002

Organism:

Synonyms: Gastrin component II,Gastrin-34,G34,

CAS NO.:

Sequence: QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF

Modifications: n-terminal Pyr,c-terminal amide

M.W:3867.23

M.F.:C176H253N43O54S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is expressed in the embryonic pancreas and is common in islet cell tumors.

Uniprot ID: P01350

Usage: For Scientific Research Use Only, Not for Human Use.

.