$ 300.0
Quantity:1mg
In stock
Description
Product name: Brain natriuretic peptide 32
Catalog#: 1230001
Organism: Human
Synonyms: BNP(1-32),BNP-32,Natriuretic peptides B,Nesiritide, SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH,
CAS NO.: 124584-08-3
Sequence: Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His
Modifications: disulfide(10-26),
M.W: 3464.07
M.F.: 143H244N50O42S4
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: The natriuretic peptides are a family of cardiac-derived hormones that have pleiotropic cardiometabolic protective effects. Three natriuretic peptides, atrial (ANP), B-type (BNP), and C-type (CNP) have been described. BNP works to facilitate cardiovascular fluid homeostasis through counterregulation of the renin-angiotensin-aldoesterone system, stimulating cyclic guanosine monophosphate, leading to smooth muscle cell relaxation. Measurements of cardiac troponins or brain-type natriuretic peptide (BNP) and its precursor, N-terminal brain-type natriuretic peptide (NT-proBNP), have become indispensable in the evaluation of patients with acute coronary syndromes and heart failure, respectively, constituting an integral part of the diagnostic algorithm and risk stratification of these conditions.
Uniprot ID: P16860
Drug Bank ID: http://www.drugbank.ca/drugs/DB04899
Usage: For Scientific Research Use Only, Not for Human Use.
