CAMP generating peptide

$ 650.0

Quantity: 10 MG

In stock

SKU: 1249001 Categories: ,

Description

Product name: CAMP generating peptide

Catalog#: 1249001

Organism: Grey flesh fly

Synonyms:

CAS NO.:

Sequence: MAGAEAEKLSGLSKYFNGTTMAGRANVAKATYAVIGLIIAYNVMKPKKK

Modifications:

M.W:5178.13

M.F.:C232H384N62O65S3

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: Q8I6M9

Usage: For Scientific Research Use Only, Not for Human Use.