Cardiodilatin-related peptide

$ 550.0

Quantity: 10 MG

In stock

Categories: ,

Description

Product name: Cardiodilatin-related peptide

Catalog#: 1229002

Organism: Human

Synonyms: CDP,

CAS NO.:

Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Modifications:

M.W:3507.94

M.F.:C152H236N38O51S3

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: P01160

Usage: For Scientific Research Use Only, Not for Human Use.