Cholecystokinin-33

$ 350.0

Quantity: 10 MG

In stock

Categories: ,

Description

Product name: Cholecystokinin-33

Catalog#: 1201002

Organism:

Synonyms: CCK33,CCK-33,

CAS NO.:

Sequence: KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF

Modifications: Y27 sulfation,

M.W:3866.39

M.F.:C167H262N50O50S3

Purity: 95% by HPLC

Counter ion: sulfate

Format: Lyophilized powder

Description: Cholecystokinin (CCK) controls nutrient delivery to the small intestine by inhibiting food intake and gastric emptying.

Uniprot ID: P06307

Usage: For Scientific Research Use Only, Not for Human Use.