Cholecystokinin-39

$ 350.0

Quantity: 10 MG

In stock

Categories: ,

Description

Product name: Cholecystokinin-39

Catalog#: 1201001

Organism:

Synonyms: CCK39,CCK-39,

CAS NO.:

Sequence: YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF

Modifications: Y33 sulfation,

M.W:4626.24

M.F.:C201H315N61O59S3

Purity: 95% by HPLC

Counter ion: sulfate

Format: Lyophilized powder

Description: Cholecystokinin (CCK) controls nutrient delivery to the small intestine by inhibiting food intake and gastric emptying.

Uniprot ID: P06307

 

Usage: For Scientific Research Use Only, Not for Human Use.