Copeptin

Description

Product name: Copeptin,no Glycosylation

Catalog#: 1254001

Organism: Human

Synonyms: ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY,

CAS NO.: 78362-34-2

Sequence: Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr

Modifications: N6 GlcNAc,

M.W: 4135.49

M.F.: C179H280F3N49O60

Purity: 95%

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Copeptin is a 39-amino-acids containing glycosylated peptide, derived from the C-terminal part of the AVP precursor. In the process of proteolysis, the AVP precursor is processed to AVP, neurophysin II, and copeptin in equimolar amounts. Plasma concentrations of arginine vasopressin are technically difficult to determine due to the small molecular size and its binding to platelets. In contrast to AVP, copeptin remains stable for several days at room temperature in serum or plasma. Copeptin serves as a bona fide biomarker of AVP release based on large studies and is very useful in the diagnosis of diabetes insipidus. In particular, copeptin concentrations 45 min after injection of insulin during an insulin tolerance test (ITT) provide the best sensitivity and specificity for detection of diabetes insipidus.

Uniprot ID: P01185

Compound ID: 71311997

 

Usage: For Scientific Research Use Only, Not for Human Use.