$ 550.0
Quantity: 10 MG
In stock
Description
Product name: Corticotropin
Catalog#: 1256101
Organism: Human
Synonyms: Adrenocorticotropic hormone,ACTH,SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF,
CAS NO.: 12279-41-3
Sequence: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
M.W: 4541.14
M.F.: C207H308N56O58S
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Adrenocorticotropic hormone (ACTH) is cleaved from its pro-opiomelanocortin (POMC) prohormone as are α-melanocyte-stimulating hormone (α-MSH), β-MSH and γ-MSH.1 ACTH and α-, β- and γ-MSH comprise the melanocortins. There are five melanocortin receptors (MCRs). ACTH binds to all MCRs, with only MC2R implicated in adrenal steroidogenesis. ACTH gel (H.P. Acthar® Gel; Questcor Pharmaceuticals Inc, Hayward, CA, USA), a slow-release formulation of full-sequence ACTH(1–39) (80 units/ml), contains additional biologically active POMC peptides (personal communication, David Young). ACTH gel has been used for decades to treat multiple sclerosis (MS) exacerbations. In 2010, the US Food and Drug Administration re-approved ACTH gel for treatment of acute exacerbations of MS in adults after a re-examination of the study data submitted in 1978. These early studies demonstrated that ACTH gel led to faster recovery than placebo in rapidly worsening MS. They also antedated an appreciation of the full physiologic actions of melanocortins.
Compound ID: 57339642
Uniprot ID: P01189
DrugBank ID: http://www.drugbank.ca/drugs/DB01285
Usage: For Scientific Research Use Only, Not for Human Use.

