CPRP

$ 550.0

Quantity: 10 MG

In stock

Categories: ,

Description

Product name: CPRP

Catalog#: 1255002

Organism: Fruit fly

Synonyms: Corazonin precursor-related peptide,Crz-associated peptide,

CAS NO.:

Sequence: SFNAASPLLANGHLHRASELGLTDLYDLQDWSSD

Modifications:

M.W:3714.98

M.F.:C163H245N45O55

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: Q26377

Usage: For Scientific Research Use Only, Not for Human Use.