$ 1,850.0
Quantity: 10 MG
In stock
Description
Product name: Galanin-like peptide
Catalog#: 1271104
Organism: Human
Synonyms: galanin-like peptide (GALP),
Sequence: APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Modifications:
M.W:6500.31
M.F.:C292H451N83O84S1
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: The hypothalamo–neurohypophyseal system is known to be involved in the regulation of body fluid balance, reproduction and stress response. Galanin-like peptide (GALP) is a 60-amino acid peptide, which has been isolated and cloned from porcine hypothalamus. GALP is abundantly expressed in the arcuate nucleus (Arc) neurons of the hypothalamus and the pituicytes of the posterior pituitary gland (PP). Intracerebroventricular administration of GALP causes significant increases of neurohypophyseal hormones (arginine vasopressin and oxytocin) and ACTH in rat plasma. GALP-containing neurons in the Arc are activated by foot shock stress. The expression of the GALP gene in the Arc is up-regulated by acute inflammatory stress but not chronic stress. On the other hand, the expression of the GALP gene in the pituicytes of the PP is up-regulated by both acute and chronic stress such as nociception, inflammation and osmotic challenge. These results suggest that GALP in the hypothalamus and PP has different pathophysiological roles in the regulation of stress responses involving the hypothalamo–neurohypophyseal system. GALP had ten-fold the orexigenic activity of galanin.
Uniprot ID: Q9UBC7
Usage: For Scientific Research Use Only, Not for Human Use.
