$ 450.0
Quantity: 10 MG
In stock
Description
Product name: hGHRH(1-29)NH2
Catalog#: 1223002
Organism: Human
Synonyms: growth hormone releasing factor 1–29 NH2, Sermorelin,Sermorelina, Sermoreline, Sermorelinum,
CAS NO.: 86168-78-7
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Modifications: C-terminal amide
M.W: 3357.88
M.F.: C149H246N44O42S
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Sermorelin is a well tolerated analogue of GHRH which is suitable for use as a provocative test of growth hormone deficiency when given as a single intravenous 1 microg/kg bodyweight dose in conjunction with conventional tests. Limited data suggest that once daily subcutaneous sermorelin 30 microg/kg bodyweight is effective in promoting growth in some prepubertal children with idiopathic growth hormone deficiency.
Uniprot ID: P01286
Compound ID: 16129620
Usage: For Scientific Research Use Only, Not for Human Use.