hBD-1

$ 3,850.0

Quantity: 5 MG

In stock

Description

Product name: hBD-1

Catalog#: 1302007

Organism: human

Synonyms: human Beta-defensin 1,BD-1,

CAS NO.:

Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Modifications: disulfide(1-5,2-4,3-6)

M.W:

M.F.:

Quantity: 5mg

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Human β-defensin 1 (hBD-1) is probably the most important antimicrobial peptide in epithelial tissues.hBD-1 is a tumor suppressor and DEFB1 is the only innate immunity gene that shows long-term balanced selection and heterozygote advantage.

Uniprot ID: P60022

 

Usage: For Scientific Research Use Only, Not for Human Use.