His-rich basic peptide

$ 550.0

Quantity: 10 MG

In stock

SKU: 1234001 Categories: ,

Description

Product name: His-rich basic peptide

Catalog#: 1234001

Organism: California sea hare

Synonyms:

CAS NO.:

Sequence: QVAQMHVWRAVNHDRNHGTGSGRHGRFLIRNRYRYGGGHLSDA

Modifications: n-terminal Pyr,

M.W:4941.42

M.F.:C211H324N80O58S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: HRBP is a myoactive peptide that excites Aplysia heart and enhances gut motility in vitro.

Uniprot ID: P01364

 

Usage: For Scientific Research Use Only, Not for Human Use.