HNP-1

$ 3,850.0

Quantity: 5 MG

In stock

Description

Product name: HNP-1

Catalog#: 1302009

Organism: human

Synonyms: Human neutrophil peptide 1,Defensin, alpha 1,Neutrophil defensin 1,HP1,HP-1,

CAS NO.:

Sequence: ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Modifications: disulfide(1-6,2-4,3-5)

M.W:

M.F.:

Quantity: 5mg

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: human alpha-defensin-1, also designated as human neutrophil peptide 1 (HNP1), is a potent inhibitor towards several enveloped virus infecting mammals.

Uniprot ID: P59665

 

Usage: For Scientific Research Use Only, Not for Human Use.