Human Beta-defensin 2

$ 2,850.0

Quantity: 10 MG

In stock

Description

Product name: Human Beta-defensin 2

Catalog#: 1302005

Organism: human

Synonyms: Beta-defensin 4A,BD-2,HBD-2,Defensin, beta 2,Skin-antimicrobial peptide 1,SAP1,

CAS NO.:

Sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Modifications: disulfide(1-5,2-4,3-6)

M.W:

M.F.:

Quantity: 5mg

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Human β-defensin (HBD)-2 is an inducible antimicrobial peptide that plays an important role in innate immunity.

Uniprot ID: O15263

 

Usage: For Scientific Research Use Only, Not for Human Use.