$ 1,200.0
Quantity: 1mg
Description
Product name: Statherin
Catalog#: 1808078
Synonyms: DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
CAS NO.:
Sequence: Asp-Ser-Ser-Glu-Glu-Lys-Phe-Leu-Arg-Arg-Ile-Gly-Arg-Phe-Gly-Tyr-Gly-Tyr-Gly-Pro-Tyr-Gln-Pro-Val-Pro-Glu-Gln-Pro-Leu-Tyr-Pro-Gln-Pro-Tyr-Gln-Pro-Gln-Tyr-Gln-Gln-Tyr-Thr-Phe
Modifications: Phosphoserine(2,3),
M.W: 5379.66
M.F.: C244H344N60O75P2
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Human salivary statherin is a low molecular weight phosphoprotein, containing 43 amino acids, that functions to inhibit spontaneous precipitation of calcium and phosphate salts (primary precipitation) from saliva and the growth of hydroxyapatite crystals (secondary precipitation) on the surface of the teeth. In addition, statherin is a major component of the “acquired” dental pellicle and functions to regulate mineralization at the surface through binding of its hydrophilic N-terminal domain to hydroxyapatite and selection of oral microorganisms that bind to the pellicle through its C-terminal domain. Further, the level of statherin in whole saliva has been reported to be higher in caries-free patients than in caries-susceptible patients and those with elevated decayed, missing, and filled teeth (DMFT) indices. Based on these observations, it is generally believed that statherin plays a critical role in protecting oral tissues from a number of common dental disorders (e.g., periodontal diseases, dental caries and oral mucosa infections).
Uniprot ID: P02808
Usage: For Scientific Research Use Only, Not for Human Use.

