IFN-alpha-2c,no Glycosylation

$9,000.00

Quantity: 1 MG

Available on backorder

SKU: 5101005 Categories: ,

Description

Product name: IFN-alpha-2c,no Glycosylation

Catalog#: 5101005

Organism: Human

Synonyms: Interferon alpha-2,Interferon alpha-A,LeIF A,

CAS NO.:

Sequence: CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRRDFGFPQEEFGNQFQKAETIPVLHEMI

QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR

KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Modifications: disulfide(1-3,2-4),

M.W:

M.F.:

Quantity: 1mg

Purity: 95% by HPLC

Format: Lyophilized powder

Description:

Uniprot ID: P01563

Usage: For Scientific Research Use Only, Not for Human Use.

Reviews

There are no reviews yet.

Be the first to review “IFN-alpha-2c,no Glycosylation”

Your email address will not be published. Required fields are marked *