Lingual antimicrobial peptide

$ 2,850.0

Quantity: 10 MG

In stock

Description

Product name: Lingual antimicrobial peptide

Catalog#: 1302004

Organism: bovine

Synonyms: LAP,

CAS NO.:

Sequence: VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

Modifications: disulfide(1-5,2-4,3-6)

M.W:

M.F.:

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Lingual antimicrobial peptide (LAP), a member of the beta-defensin family in cows, is involved in the innate immune system and plays a crucial role in killing a large variety of microorganisms.

Uniprot ID: Q28880

 

Usage: For Scientific Research Use Only, Not for Human Use.