$ 480.0
Quantity: 5mg
In stock
Description
Product name: Lunasin-44
Catalog#: 2202035
Organism: Glycine max (Soybean)
Synonyms: 2S albumin small chain, Aspartic acid-rich peptide, SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDN,
Sequence: Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asn
M.W: 5142.43
M.F.: C208H327N67O80S3
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Lunasin peptide from soybean contains 44 amino acids and has a C-terminal asparagine immediately following the aspartic acid tail. The presence of the C-terminal asparagine is consistent with the published cDNA sequence. Lunasin has been shown to exhibit robust chemopreventive and chemotherapeutic activities. Lunasin has chemotherapeutic activity both in vitro and in vivo in various cancer models, including colon and breast cancer. Previous studies from our laboratory have established a novel, functional role for Lunasin in decreasing proliferation of non-small cell lung cancer (NSCLC) cells by suppressing integrin signaling through αvβ3. These results also suggest that the C-terminal asparagine residue present in the purified soy-derived lunasin does not significantly affect lunasin’s biological activity.
Uniprot ID: P19594
Usage: For Scientific Research Use Only, Not for Human Use.


