MIP-3-beta,human

$2,500.00

Quantity: 1 MG

Available on backorder

SKU: 5102009 Categories: ,

Description

Product name: MIP-3-beta,human

Catalog#: 5102009

Source: chemical synthesis

Synonyms: Epstein-Barr virus-induced molecule 1 ligand chemokine,EBI1 ligand chemokine,ELC,Macrophage inflammatory protein 3 beta,Small-inducible cytokine A19,

CAS NO.:

Sequence:

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Modifications: disulfide(1-3,2-4),

M.W:

M.F.:

Quantity: 1mg

Purity: 95% by HPLC

Format: Lyophilized powder

Description:

Uniprot ID: Q99731

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reference:

Reviews

There are no reviews yet.

Be the first to review “MIP-3-beta,human”

This website uses non-personal cookies to give you best relevant experience. Dismiss