Neuropeptide F(NPF)

$ 650.0

Quantity: 50 MG

In stock

Description

Product name: Neuropeptide F(NPF)

Catalog#: 2229004

Organism: Whiteleg shrimp

Synonyms:

CAS NO.:

Sequence: KPDPSQLANMAEALKYLQELDKYYSQVSRPRF

Modifications: C-terminal amide,

M.W:3786.29

M.F.:C170H266N46O50S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: The neuropeptide Fs (NPFs) are an invertebrate subgroup of the FMRFamide-like peptides, and are proposed by some to be the homologs of vertebrate neuropeptide Y. NPF-fed shrimp also showed a significant increase in growth relative to the control group. Our data suggest that NPF is present in both the nervous system and midgut of penaeid shrimp, functioning, at least in part, as a powerful orexigenic agent.

Uniprot ID: F6KM62

 

Usage: For Scientific Research Use Only, Not for Human Use.