$ 950.0
Quantity: 1mg
Description
Product name: OAIP-1
Catalog#: 1808016
Synonyms: orally active insecticidal peptide 1,U1-TRTX-Sp1a, DCGHLHDPCPNDRPGHRTCCIGLQCRYGKCLVRV,
Sequence: Asp-Cys-Gly-His-Leu-His-Asp-Pro-Cys-Pro-Asn-Asp-Arg-Pro-Gly-His-Arg-Thr-Cys-Cys-Ile-Gly-Leu-Gln-Cys-Arg-Tyr-Gly-Lys-Cys-Leu-Val-Arg-Val-NH2
Modifications: disulfide(1-4,2-5,3-6),C-terminal amide,
M.W: 3816.39
M.F.: C157H248N56O44S6
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Orally active insecticidal peptide (OAIP-1) is highly lethal to termites, mealworms, and the cotton bollworm.OAIP-1 remains completely intact for at least one week at temperatures up to 30°C and is stable for hours in insect hemolymph.
Uniprot ID: K7N5K9
Usage: For Scientific Research Use Only, Not for Human Use.
