$ 2,180.0
Quantity:1mg
Available on backorder
Description
Product name: Osteocalcin
Catalog#: 1808052
Synonyms: Bone Gla protein,BGP,Gamma-carboxyglutamic acid-containing protein, YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV,
CAS NO.: 136461-80-8
Sequence: Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Gla-Pro-Arg-Arg-Gla-Val-Cys-Gla-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val
Modifications: 4-carboxyglutamate(21,24),disulfide,
M.W: 5929.52
M.F.: C269H381N67O82S2
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Osteocalcin (OC) is a non-collagenous, vitamin K-dependent protein secreted in the late stage of osteoblasts differentiation. The presence of the three residues of γ-carbossiglutamatic acid, specific of the active form of OC protein, allows the protein to bind calcium and consequently hydroxyapatite.
Uniprot ID: P02818
Usage: For Scientific Research Use Only, Not for Human Use.
