Oxyntomodulin

$ 450.0

Quantity: 10 MG

In stock

SKU: 1207002 Categories: ,

Description

Product name: Oxyntomodulin

Catalog#: 1207002

Organism: Human

Synonyms: OXM,OXY,

CAS NO.:

Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Modifications:

M.W:4449.86

M.F.:C192H295N61O60S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Oxyntomodulin (OXM) is a peptide hormone released from the gut in post-prandial state that activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR) resulting in superior body weight lowering to selective GLP1R agonists. OXM reduces food intake and increases energy expenditure in humans.

Uniprot ID: P01275

 

Usage: For Scientific Research Use Only, Not for Human Use.