Pancreastatin

$1,750.00

Quantity: 10 MG

1 in stock

Categories: ,

Description

Product name: Pancreastatin

Catalog#: 1295001

Organism: Human

Synonyms:

CAS NO.:

Sequence: SEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG

Modifications: Phosphoserine (29),

M.W:5080.36

M.F.:C212H333N61O82S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: P10645

Usage: For Scientific Research Use Only, Not for Human Use.

Reviews

There are no reviews yet.

Be the first to review “Pancreastatin”

This website uses non-personal cookies to give you best relevant experience. Dismiss