$ 360.0
Quantity:50mg
In stock
Description
Product name: PTH(1-34)
Catalog#: 1296001
Organism: Human
Synonyms: Parathormone,Parathyrin,Teriparatide,SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF,
CAS NO.: 99294-94-7
Sequence: Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
M.W: 4117.77
M.F.: C181H291N55O51S2
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Teriparatide (PTH 1-34) is the N-terminal fragment of the intact hormone and is approved for use in the treatment of osteoporosis in both the United States and Europe. Intermittent treatment with PTH(1-34) promotes osteoblast and osteoclast recruitment through activation of PTH1R with resultant net bone gain. Previous studies have demonstrated that PTH 1-34, a biologically active peptide fragment of parathyroid hormone, stimulates mesenchymal stem cell populations. Both in vivo and in vitro studies have demonstrated the osteogenic effect of PTH 1-34, and recent work suggests that it also promotes chondrogenesis. As PTH 1-34 is a systemic hormone, it is important to consider the effects it may have on other cells in the mesenchymal lineage, including tendon cells. A stimulatory role for PTH 1-34 on tendon-to-bone healing was first suggested by Rodeo et al. who reported increased bone and fibrocartilage formation after recombinant parathyroid hormone (rhPTH) treatment in a rat rotator cuff model. Given the anabolic effect of PTH 1-34 on fracture healing and tendon-to-bone healing, it may also enhance extracellular matrix deposition and organization during tendon-to-tendon healing.
Uniprot ID: P01270
Usage: For Scientific Research Use Only, Not for Human Use.

