S20K Amylin

$660.00

Quantity:1mg

5 in stock

SKU: 1219005 Category:

Description

Product name: S20K IAPP

Catalog#: 1219005

Organism: Human

Synonyms: KCNTATCATQRLANFLVHSKNNFGAILSSTNVGSNTY-NH2, S20K Amylin,

Sequence: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Lys-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Modifications: Disulfide(2-7),C-terminal amide,

M.W: 3944.38

M.F.: C168H268N52O54S2

Purity: 95%

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: An S20K mutant forms amyloid with an 18-fold longer lag phase in homogeneous solution. Thioflavin T binding assays, together with experiments using a p-cyanophenylalanine (p-cyanoPhe) variant of human IAPP, show that the designed S20K mutant inhibits amyloid formation by human IAPP.

Uniprot ID: P10997

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reviews

There are no reviews yet.

Be the first to review “S20K Amylin”

This website uses non-personal cookies to give you best relevant experience. Dismiss