$ 350.0
Quantity: 10 MG
In stock
Description
Product name: S20K IAPP
Catalog#: 1219105
Organism: Human
Synonyms: KCNTATCATQRLANFLVHSKNNFGAILSSTNVGSNTY-NH2,
Sequence: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Lys-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Modifications: Disulfide(2-7),C-terminal amide,
M.W: 3944.38
M.F.: C168H268N52O54S2
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: An S20K mutant forms amyloid with an 18-fold longer lag phase in homogeneous solution. Thioflavin T binding assays, together with experiments using a p-cyanophenylalanine (p-cyanoPhe) variant of human IAPP, show that the designed S20K mutant inhibits amyloid formation by human IAPP.
Uniprot ID: P10997
Usage: For Scientific Research Use Only, Not for Human Use.
