taipan natriuretic peptide c

$ 1,280.0

Quantity: 50 MG

In stock

Description

Product name:  taipan natriuretic peptide c

Catalog#: 2228001

Organism: Papuan taipan

Synonyms: Natriuretic peptide TNP-c,Taipan natriuretic peptide,Venom natriuretic peptide OxsSNPc

CAS NO.:

Sequence: SDSKIGNGCFGFPLDRIGSVSGLGCNRIMQNPPKKFSGE

Modifications: disulfide(9-25),

M.W:4112.65

M.F.:C177H284N52O55S3

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: taipan natriuretic peptide c (TNPc), which was isolated from the venom of the inland taipan (Oxyuranus microlepidotus) displaying similar activity to ANP and DNP at rat natriuretic peptide receptor A.

Uniprot ID: P28374

 

Usage: For Scientific Research Use Only, Not for Human Use.