Teduglutide

$720.00

Quantity:50mg

2 in stock

Description

Product name: Teduglutide

Catalog#: 1209002

Synonyms: (Gly2)GLP-2,[2-Glycine]glucagon-like peptide II (human),HGDGSFSDEMNTILDNLAARDFINWLIQTKITD,

CAS NO.: 287714-30-1

Sequence: His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp

M.W: 3752.13

M.F.: C164H252N44O55S

Purity: 95%

Counter ion: Acetate

Format: Lyophilized powder

Description: Teduglutide, being developed by NPS Allelix and licensee Nycomed, is a protease-resistant analog of GLP-2 for the potential treatment of gastrointestinal disease.Teduglutide represents a novel, efficacious drug capable of increasing intestinal growth and improving intestinal function, and may change clinical management of intestinal disease and damage.

Drug Bank ID: http://www.drugbank.ca/drugs/DB08900

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reviews

There are no reviews yet.

Be the first to review “Teduglutide”

Your email address will not be published. Required fields are marked *