
$ 720.0


2 in stock


Product name: Teduglutide

Catalog#: 1209002

Synonyms: (Gly2)GLP-2,[2-Glycine]glucagon-like peptide II (human),HGDGSFSDEMNTILDNLAARDFINWLIQTKITD,

CAS NO.: 287714-30-1

Sequence: His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp

M.W: 3752.13

M.F.: C164H252N44O55S

Purity: 95%

Counter ion: Acetate

Format: Lyophilized powder

Description: Teduglutide, being developed by NPS Allelix and licensee Nycomed, is a protease-resistant analog of GLP-2 for the potential treatment of gastrointestinal disease.Teduglutide represents a novel, efficacious drug capable of increasing intestinal growth and improving intestinal function, and may change clinical management of intestinal disease and damage.

Drug Bank ID: http://www.drugbank.ca/drugs/DB08900


Usage: For Scientific Research Use Only, Not for Human Use.