Tracheal antimicrobial peptide

$ 2,850.0

Quantity: 10 MG

In stock

Description

Product name: Tracheal antimicrobial peptide

Catalog#: 1302003

Organism: bovine

Synonyms: TAP,

CAS NO.:

Sequence: NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK

Modifications: disulfide(1-5,2-4,3-6)

M.W:

M.F.:

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Tracheal antimicrobial peptide (TAP) is a β-defensin produced by mucosal epithelial cells of cattle.

Uniprot ID: P25068

 

Usage: For Scientific Research Use Only, Not for Human Use.