Vosoritide

$ 450.0

Quantity:5mg

In stock

SKU: 1231005-2 Category:

Description

Product name: Vosoritide

Catalog#: 1231005-2

Organism: Human

Synonyms: Vosoritide, BMN 111, PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC,

CAS NO.: 1480724-61-5

Sequence: H-Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH

Modifications: disulfide,

M.W: 4102.73

M.F.: C176H290N56O51S3

Purity: 95%

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Achondroplasia (ACH), the most common form of human dwarfism, is caused by an activating autosomal dominant mutation in the fibroblast growth factor receptor-3 gene. Genetic overexpression of C-type natriuretic peptide (CNP), a positive regulator of endochondral bone growth, prevents dwarfism in mouse models of ACH. However, administration of exogenous CNP is compromised by its rapid clearance in vivo through receptor-mediated and proteolytic pathways. Using in vitro approaches, we developed modified variants of human CNP, resistant to proteolytic degradation by neutral endopeptidase, that retain the ability to stimulate signaling downstream of the CNP receptor, natriuretic peptide receptor B. The variants tested in vivo demonstrated significantly longer serum half-lives than native CNP. Subcutaneous administration of one of these CNP variants (BMN 111) resulted in correction of the dwarfism phenotype in a mouse model of ACH and overgrowth of the axial and appendicular skeletons in wild-type mice without observable changes in trabecular and cortical bone architecture. Moreover, significant growth plate widening that translated into accelerated bone growth, at hemodynamically tolerable doses, was observed in juvenile cynomolgus monkeys that had received daily subcutaneous administrations of BMN 111. BMN 111 was well tolerated and represents a promising new approach for treatment of patients with ACH.

Uniprot ID: P23582

Compound ID: 119058036

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Use coupon code : Q74SBZGH to save $100 NOW! Dismiss