$ 480.0
Quantity: 10mg
In stock
Description
Product name: Galanin
Catalog#: 1271001
Organism: Human
Synonyms: Gal, GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS,
CAS NO.: 119418-04-1
Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser
M.W: 3157.46
M.F.: C139H210N42O43
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Galanin (GAL) is a neuropeptide widely distributed in neurons within the central nervous system (CNS). Galanin exerts its biological activities through three different G protein-receptors and participates in a number of functions, including mood regulation. The GAL1–3 receptors are involved in a number of central functions modulating neuroendocrine levels, pain control, cardiovascular functions, addiction, and food intake. GAL is also involved in mood regulation, including depression-related and anxiety-like behaviors.
Uniprot ID: P22466
Usage: For Scientific Research Use Only, Not for Human Use.
