PTH(1-34)

Description

Product name: PTH(1-34)

Catalog#: 1296001

Organism: Human

Synonyms: Parathormone,Parathyrin,Teriparatide,SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF,

CAS NO.: 99294-94-7

Sequence: Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

M.W: 4117.77

M.F.: C181H291N55O51S2

Purity: 95%

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Teriparatide (PTH 1-34) is the N-terminal fragment of the intact hormone and is approved for use in the treatment of osteoporosis in both the United States and Europe. Intermittent treatment with PTH(1-34) promotes osteoblast and osteoclast recruitment through activation of PTH1R with resultant net bone gain. Previous studies have demonstrated that PTH 1-34, a biologically active peptide fragment of parathyroid hormone, stimulates mesenchymal stem cell populations. Both in vivo and in vitro studies have demonstrated the osteogenic effect of PTH 1-34, and recent work suggests that it also promotes chondrogenesis. As PTH 1-34 is a systemic hormone, it is important to consider the effects it may have on other cells in the mesenchymal lineage, including tendon cells. A stimulatory role for PTH 1-34 on tendon-to-bone healing was first suggested by Rodeo et al. who reported increased bone and fibrocartilage formation after recombinant parathyroid hormone (rhPTH) treatment in a rat rotator cuff model. Given the anabolic effect of PTH 1-34 on fracture healing and tendon-to-bone healing, it may also enhance extracellular matrix deposition and organization during tendon-to-tendon healing.

Uniprot ID: P01270

 

Usage: For Scientific Research Use Only, Not for Human Use.