$ 540.0
Quantity:1mg
In stock
Description
Product name: Copeptin,no Glycosylation
Catalog#: 1254001
Organism: Human
Synonyms: ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY,
CAS NO.: 78362-34-2
Sequence: Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr
Modifications: N6 GlcNAc,
M.W: 4135.49
M.F.: C179H280F3N49O60
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Copeptin is a 39-amino-acids containing glycosylated peptide, derived from the C-terminal part of the AVP precursor. In the process of proteolysis, the AVP precursor is processed to AVP, neurophysin II, and copeptin in equimolar amounts. Plasma concentrations of arginine vasopressin are technically difficult to determine due to the small molecular size and its binding to platelets. In contrast to AVP, copeptin remains stable for several days at room temperature in serum or plasma. Copeptin serves as a bona fide biomarker of AVP release based on large studies and is very useful in the diagnosis of diabetes insipidus. In particular, copeptin concentrations 45 min after injection of insulin during an insulin tolerance test (ITT) provide the best sensitivity and specificity for detection of diabetes insipidus.
Uniprot ID: P01185
Compound ID: 71311997
Usage: For Scientific Research Use Only, Not for Human Use.

